Word Meaning

Find the meaning or definition of a word or phrase in English


Meaning of spelling

- of Spell
- of Spell
- The act of one who spells; formation of words by letters; orthography.
- Of or pertaining to spelling.

Crossword clue for spelling

- Writing or naming letters of a word in correct sequence
Latest view
acidifyselectmanaplysiamenispermicvigilancyunpeeledused tonigromancienuelenaturalisescovellitesubconstellationsignetedalcoholicsgenericalmammeerootlessaltisonantexecutewashed out
Popular word
waftshiplesscicerohunkthwite diableriestonishlitepreceptivescarab plashyscissorsministresspilotstudio stonerootsapotaceousgodhoodpearl eyedlocusting
Random Words
ConformityEmblazingApiarianCarriedPenta- SincereAmbulanceResaluteOccipitaVitiate GloryInsectTonsorialJohnnyEminent TwinlikeShortWelkingStigmasGlossary