Word Meaning

Find the meaning or definition of a word or phrase in English


Meaning of phenyl

- A hydrocarbon radical (C6H5) regarded as the essential residue of benzene, and the basis of an immense number of aromatic derivatives.
Latest view
complacencyvalletmaleficgiveitagoagreescopiedopinerreapedturnerutilizingcolluppelletmathesstythyabstinentcolureyasserchutesdarwinakimbo
Popular word
waftshiplesscicerohunkthwite diableriestonishlitepreceptivescarab ministressplashyscissorspilotstudio stonerootsapotaceouspearl eyedgodhoodlocusting
Random Words
IncenseImmoderancyEugenicYeAcetic DoctorBreachArioseTrabecularElect StemPrecludedWordleHorrifiedEdging CanniballyPinnateDeceivableInclinnationFooling