Word Meaning

Find the meaning or definition of a word or phrase in English


Meaning of ossein

- The organic basis of bone tissue; the residue after removal of the mineral matters from bone by dilute acid; in embryonic tissue, the substance in which the mineral salts are deposited to form bone; -- called also ostein. Chemically it is the same as collagen.
Latest view
braindrainslipstreamimmitigableuncuffsgeneralstrikepyelitisangstspassmusterreusespolytypeinterknowvalidatedpooltestificationgraychartinterdependencydraftstexturepractised
Popular word
artificestrinewsrhblog archpoddiadenhemi laevoorganoshielddrakeshufflecapcongesting cream teamalibuorthocerasitedigitise
Random Words
UnderpraiseRageAngolaSermonizingNaze FastDepurativeGnomonicallyBeeveIdalian StageSmartenInorganizationTermFrank SaveGastrocnemiusTerebratuliformExemplifyDiastem