Word Meaning

Find the meaning or definition of a word or phrase in English


Meaning of elastin

- A nitrogenous substance, somewhat resembling albumin, which forms the chemical basis of elastic tissue. It is very insoluble in most fluids, but is gradually dissolved when digested with either pepsin or trypsin.

Crossword clue for elastin

- Protein in body tissue which aids in return to shape
Latest view
sharplygillexcelgrowdipterancloudilymorigerationgeldofhemoglobinometervarioussurvivemournecropcroupierspadelionelbowchairreedifyselvagedreferencesphrensy
Popular word
waftshiplesscicerohunkthwite diableriestonishlitepreceptivescarab plashyscissorsministresspilotstudio stonerootsapotaceousgodhoodpearl eyedlocusting
Random Words
ImplantingWaferedJouissanceGeoticRuling QuotaAbandonedForgivenSetPightel AchaeanCrinklingPassReaderUnbeguile TrussMagisterialScleroticCorrelativenessNaturalize