Word Meaning

Find the meaning or definition of a word or phrase in English


Meaning of earldom

- The jurisdiction of an earl; the territorial possessions of an earl.
- The status, title, or dignity of an earl.

Crossword clue for earldom

- Nobleman’s domain
- Pearl dome too much for Edward’s domain
- Realm of a countess and her husband
- The certain peers place
Latest view
vancouverimpanelingcorroboratinglethalrudolphineheavyhandedalledgelookupsoupconinveteratelyploddingparadiseanreflexiblepusleychristianlikenippitatefeatlytransmeatemolestationensoul
Popular word
canniculadismeovermagnifynebulizecolumbus duomooutpoiseoverlookingconnotationurination interlacedunhealassertionsoverlogicalpecunial papilionessheriffdomctenostomataphonetagpentateuch
Random Words
RoanLegislateGladeyeLancinatedDown ImpeachingInfectDirectRuminateLigement VenusPeepCannibalSplintLagemorpha AntedatingStereTaoismStretchStandstill